PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco007021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 219aa    MW: 24345.3 Da    PI: 7.6665
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco007021.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.76.1e-21666257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 ++R+++t+eql +Lee++++  r+p+a+++++++++l    +++ ++V++WFqN++a++++
  Aco007021.1  6 STRWCPTPEQLMILEEMYRSgVRTPNAAQIQQITAHLsfygKIEGKNVFYWFQNHKARDRQ 66
                 58*****************99*************************************996 PP

2Wus_type_Homeobox122.41.7e-39567264
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
                       ++tRW+PtpeQ++iLee+y+sG+rtPn+++iq+ita+L+ yGkie+kNVfyWFQN+kaR+rqk
        Aco007021.1  5 PSTRWCPTPEQLMILEEMYRSGVRTPNAAQIQQITAHLSFYGKIEGKNVFYWFQNHKARDRQK 67
                       689***********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.252267IPR001356Homeobox domain
SMARTSM003898.3E-6471IPR001356Homeobox domain
CDDcd000862.62E-5567No hitNo description
PfamPF000461.3E-18666IPR001356Homeobox domain
SuperFamilySSF466891.5E-11767IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-8866IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MPQTPSTRWC PTPEQLMILE EMYRSGVRTP NAAQIQQITA HLSFYGKIEG KNVFYWFQNH  60
KARDRQKLRR RLSRHQQMLH HQLGHHPDQE ASPPPPSTPP PAAATASGSH PNIQLHPHNS  120
SPFFHQVAWM GYFQEAVDMQ GMDLVGKLGA GESSEEESTN AYDHQEWMTM MGLSCTASTS  180
LPPSCKPPKT LDLFPLKSSG LKDECTSSKS SSCSTSTN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008776170.15e-74PREDICTED: WUSCHEL-related homeobox 3B-like
SwissprotQ70UV11e-47WOX3A_MAIZE; WUSCHEL-related homeobox 3A
TrEMBLD9N1B73e-70D9N1B7_9POAL; PRESSED FLOWER a
STRINGGSMUA_Achr2P16080_0016e-69(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21773897
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28610.18e-36WOX family protein